PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_011483-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 242aa    MW: 27847.2 Da    PI: 5.3101
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_011483-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.89.2e-193791256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     +++++ft+eq++ Le+ Fe++ ++  +++ + A++lgL+ rqV +WFqN+Ra++k
  AHYPO_011483-RA 37 KNKRRFTDEQVKSLETIFESETKLEPRKKVQVARELGLQPRQVAIWFQNKRARWK 91
                     67789*************************************************9 PP

2HD-ZIP_I/II116.81.2e-3738129293
      HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      +krr+++eqvk+LE+ Fe+e+kLep++Kv++areLglqprqva+WFqn+RAR+k+k++Ek+y++Lk++y++lk++ e+++ke e+L+e+l+e
  AHYPO_011483-RA  38 NKRRFTDEQVKSLETIFESETKLEPRKKVQVARELGLQPRQVAIWFQNKRARWKSKEIEKNYRVLKANYENLKTRLETIKKERESLQEQLQE 129
                      79***************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.04E-182294IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-192292IPR009057Homeodomain-like
PROSITE profilePS5007117.9933393IPR001356Homeobox domain
SMARTSM003891.3E-163597IPR001356Homeobox domain
PfamPF000463.6E-163791IPR001356Homeobox domain
CDDcd000866.07E-144294No hitNo description
PRINTSPR000312.8E-56473IPR000047Helix-turn-helix motif
PROSITE patternPS0002706891IPR017970Homeobox, conserved site
PRINTSPR000312.8E-57389IPR000047Helix-turn-helix motif
PfamPF021833.3E-1193134IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MMMMMQGGEL SPEATEADIE SLSPEEELPT MKKRKSKNKR RFTDEQVKSL ETIFESETKL  60
EPRKKVQVAR ELGLQPRQVA IWFQNKRARW KSKEIEKNYR VLKANYENLK TRLETIKKER  120
ESLQEQLQEL RSLLGKSHDR DSDKDFVSNS RDISRGNGEI AAEIKATSSS LQDEMDHQGV  180
LYSDDDKSGN MAYLGHEELE LLKISDGIDG SYIPPAKWCN LDAGNLFDLT STSSHWWESW  240
T*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010666163.11e-109PREDICTED: homeobox-leucine zipper protein ATHB-12-like
TrEMBLA0A0J8B8M11e-113A0A0J8B8M1_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.21e-42homeobox 7